PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00050340-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 123aa    MW: 14186.7 Da    PI: 4.4008
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00050340-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.96.2e-1074114143
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 
                       ++ ++++E++l+ ++ ++lG++ W++Ia +++ gRt++++  +
  PSME_00050340-RA  74 KMDFSEDEEDLISRLYNLLGPR-WALIAGRIP-GRTAEEIEKY 114
                       5679****************99.*********.*****99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.8E-573121IPR001005SANT/Myb domain
PfamPF002493.3E-974114IPR001005SANT/Myb domain
SuperFamilySSF466898.58E-775114IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-1077114IPR009057Homeodomain-like
CDDcd001678.01E-877115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
MQSSRSVDSV LPPDCCYYLR STVLPFRIGL FFFSNHYHFL NSRGTMSDMD RSSSDDNVSV  60
DSQVGAEDVN ENYKMDFSED EEDLISRLYN LLGPRWALIA GRIPGRTAEE IEKYCSRRYC  120
SED
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010923911.11e-26PREDICTED: transcription factor CPC-like
TrEMBLB8LRL35e-37B8LRL3_PICSI; Putative uncharacterized protein
STRINGGSMUA_Achr10P09220_0012e-23(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.12e-16MYB_related family protein